PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462948760
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family MYB
Protein Properties Length: 190aa    MW: 21825.3 Da    PI: 10.3103
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462948760genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding61.22.1e-191764148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+WTt+Ed+llv+ v+q+G g+W+++++  g++R++k+c++rw +yl
        462948760 17 KGPWTTQEDKLLVEHVRQHGEGRWNSVSKLTGLKRSGKSCRLRWVNYL 64
                     79********************************************97 PP

2Myb_DNA-binding55.21.7e-1770114147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+ T++E+ ++v++++++G++ W+tIar ++ gRt++++k++w+++
        462948760  70 RGKITPQEETIIVQLHALWGNR-WSTIARSLP-GRTDNEIKNYWRTH 114
                      8999******************.*********.************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.4081264IPR017930Myb domain
SuperFamilySSF466895.99E-3015111IPR009057Homeodomain-like
SMARTSM007175.4E-161666IPR001005SANT/Myb domain
PfamPF002496.3E-181764IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.602.6E-231871IPR009057Homeodomain-like
CDDcd001675.27E-111964No hitNo description
PROSITE profilePS5129425.42765119IPR017930Myb domain
SMARTSM007177.9E-1669117IPR001005SANT/Myb domain
PfamPF002494.3E-1570114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.3E-2472117IPR009057Homeodomain-like
CDDcd001678.08E-1074115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 190 aa     Download sequence    Send to blast
MEGQLSWGRQ EVDGWRKGPW TTQEDKLLVE HVRQHGEGRW NSVSKLTGLK RSGKSCRLRW  60
VNYLRPDLKR GKITPQEETI IVQLHALWGN RWSTIARSLP GRTDNEIKNY WRTHFKKGKP  120
SKNIERARAR FLKQRREMQS QQQQFQLVGK DEDKHDATRV DGTVGDEEDR GSAVVDDNAA  180
HADDDGGGGG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-271711727126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK1096201e-140AK109620.1 Oryza sativa Japonica Group cDNA clone:002-138-A05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004978126.12e-96PREDICTED: transcription repressor MYB6-like
SwissprotP813916e-51MYB05_ANTMA; Myb-related protein 305
TrEMBLK3Y9D02e-96K3Y9D0_SETIT; Uncharacterized protein
STRINGSi010822m5e-96(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32433584
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13480.17e-67myb domain protein 79